Canada Post Xpresspost1–2 day delivery across CanadaFree on orders over $200

Peptide Calculator — Reconstitution, Dilution, Molarity, Aliquots & Sequence Properties

Free laboratory reference tools for research peptides. Work out solution concentration from vial mass and diluent volume, plan C₁V₁ = C₂V₂ dilutions, convert mass to molarity with 24 compound presets, split a stock into aliquots, and estimate molecular weight, pI and GRAVY from a sequence. Results update as you type; nothing is sent to a server.

Reconstitution1 of 5

Tool 01

Reconstitution Calculator

Enter the peptide mass on the vial label and the volume of diluent added. The tool returns the stock concentration and the volume that contains a chosen mass of peptide.

0 µL10 µL20 µL30 µL40 µL50 µL

50 µL

on a 50 µL scale

Research solution, pipette.

Concentration5mg/mL
Draw Volume50µL
Draws / Vial40draws
Per 100 µL500µg

C = 10 mg ÷ 2 mL = 5 mg/mL  ·  V = 250 µg ÷ 5000 µg/mL = 50 µL

Volume for Neighbouring Masses

125 µg25 µL
250 µg50 µL
500 µg100 µL

Laboratory reference only. Volumes are for pipetting research solutions; no administration is implied. Verify the measured content on the lot’s certificate of analysis before relying on the label mass.

Tool 02

Dilution Planner (C₁V₁ = C₂V₂)

Volume of stock to transfer, and diluent to add, to reach a target concentration and final volume. Switch to serial mode for a fixed-factor series.

C₁ × V₁ = C₂ × V₂  →  V₁ = (C₂ × V₂) ÷ C₁

Transfer

Stock

10 mg/mL

Working

1 mg/mL

dashed line = stock aliquot

Stock to transfer

0.1mL

100 µL

Diluent to add

0.9mL

Dilution factor

1 : 10

Tool 03

Mass ↔ Molarity Converter

Convert a peptide mass in a given volume to molar concentration, or find the mass to weigh for a target molarity. 24 compound presets with molecular weights of the free peptide.

moles = mass (g) ÷ MW (g/mol)  ·  molarity (M) = moles ÷ volume (L)

Prepared vial

2.50 mg/mL

2 mL fill

Molar concentration

1.761mM

Total substance

3.522µmol

Mass concentration

2.500mg/mL

Powder to weigh

5.000mg

Equal to peptide mass at 100 % net content.

Where this lands · log scale

1.761 mM
1 nM10 nM100 nM1 µM10 µM100 µM1 mM10 mM100 mM

Tool 04

Aliquot & Storage Planner

Split a reconstituted stock into single-use tubes, accounting for dead volume, and see general stability ranges by temperature.

mass per aliquot = (peptide ÷ reconstitution volume) × aliquot volume

Aliquot rack

10 × 200 µL

the vial divides evenly

Volume per aliquot

200µL

Peptide per aliquot

1.00mg

Concentration

5.00mg/mL

Recoverable per tube

975µg

2.5 % held back as dead volume

Why aliquot at allA stock that is thawed and refrozen for every experiment goes through that stress once per use; single-use aliquots go through it once, full stop. Label each tube with the compound, concentration and date, freeze upright, and thaw on ice rather than at room temperature.

Storage temperature & expected stability

+20 °CAmbient
Lyophilised
Weeks — shipping window only
In solution
Hours — working session only
+4 °CRefrigerated
Lyophilised
Months
In solution
2–4 weeks in solution
−20 °CFreezer
Lyophilised
1–2 years
In solution
1–3 months as single-use aliquots
−80 °CUltra-low
Lyophilised
Several years
In solution
6–12 months as single-use aliquots

Ranges are general handling guidance for research peptides and are not a substitute for the stability data on a specific certificate of analysis. Peptides containing Met, Cys or Trp oxidise faster than the table suggests; protect those from light and headspace oxygen.

General handling ranges for research peptides; they are not a substitute for stability data on a specific certificate of analysis. Avoid repeated freeze–thaw: single-use aliquots go through the cycle once.

Tool 05

Sequence Property Analyser

Paste a one-letter amino acid sequence to estimate molecular weight, isoelectric point, net charge at pH 7, GRAVY hydropathy and ε₂₈₀. Assumes free termini, reduced cysteines and standard L-amino acids.

One-letter sequence

Residues — 15 total

GEPPPGKPADDAGLV

Composition

Basic (+)1 · 7%Acidic (−)3 · 20%Polar0 · 0%Hydrophobic4 · 27%Structural7 · 47%

Residues

15aa

Molecular weight

1419.55Da

Average mass, free acid, unmodified termini.

Isoelectric point

3.88pI

Estimated from side-chain pKa values.

Net charge · pH 7

-2.02

GRAVY

-0.693

Negative — net hydrophilic.

ε₂₈₀ (reduced)

0M⁻¹cm⁻¹

Buffer pH

pH 7.4 · net charge -2.06
0714

Net charge vs pH

pH 7.4 -2.06
pI 3.88
pH 7.4 · -2.06

x: pH · y: net charge · drag or hover to read the curve

Solvent selectionAcidic peptide — dissolve in a slightly basic aqueous bufferWith an estimated pI below 6 the peptide carries net negative charge at neutral pH and is most soluble above its pI. Sterile water or a dilute basic buffer (e.g. 0.1 M ammonium bicarbonate) is the usual first attempt. Add solvent slowly down the vial wall and swirl — never vortex or shake.Avoid buffers between pH 2.9 and 4.9.

Concentration check by A₂₈₀

No tryptophan or tyrosine, so this peptide has essentially no absorbance at 280 nm and A₂₈₀ cannot be used to check its concentration. Use a colorimetric assay (BCA) or quantitative amino-acid analysis instead — a reading at 205–214 nm on the peptide bond is possible but far more sensitive to buffer interference.

Values are computed from the primary sequence assuming free (unmodified) N- and C-termini, all cysteines reduced, and standard L-amino acids. Acetylation, amidation, cyclisation, non-standard residues and counter-ions all shift the real figures — treat these as a starting point, not as a certificate of analysis.

Understanding the Maths Behind Each Tool

Concentration from reconstitution

C (mg/mL) = peptide mass (mg) ÷ diluent volume (mL). 10 mg in 2 mL gives 5 mg/mL, which is 5,000 µg/mL or 5 µg/µL. The volume holding a target mass is V = mass ÷ C.

Net peptide content

A vial’s label mass and its measured content differ. Every Eppix Labs certificate reports both; enter measured ÷ labelled as the net content so concentrations reflect what the lab found rather than the nominal figure.

Dilution and serial dilution

C₁V₁ = C₂V₂. To go from 5 mg/mL to 1 mg/mL in 1,000 µL, transfer 200 µL of stock into 800 µL of diluent. A serial series repeats the same factor from each new tube.

Mass to molarity

M = mass (g) ÷ MW (g/mol) ÷ volume (L). 10 mg of BPC-157 (1,419.5 g/mol) in 2 mL is 3.52 mM. Reverse it to find the mass to weigh for a target molarity.

Isoelectric point and solubility

The pI is the pH at which a peptide’s positive and negative charges cancel and solubility is at its minimum. Acidic peptides (pI below 6) dissolve best slightly above their pI; basic peptides slightly below.

Concentration by A₂₈₀

Tryptophan (5,500) and tyrosine (1,490 M⁻¹cm⁻¹) absorb at 280 nm. A sequence with neither cannot be quantified this way — use the certificate’s HPLC content instead.

Molecular Weight Reference — Research Peptides

Free peptide (non-salt) values used by the converter. Lot-specific figures are on each certificate of analysis.

CompoundMW (g/mol)Notes
BPC-1571,419.5Sequence: GEPPPGKPADDAGLV
TB-500 (Thymosin β4)4,963.4Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
GHK-Cu403.9Copper complex; GHK free tripeptide is 340.38 Da.
KPV342.4Sequence: KPV
Ipamorelin711.9Contains non-standard residues (Aib, 2-Nal).
CJC-1295 (no DAC)3,367.9Also sold as Mod GRF 1-29.
Tesamorelin5,135.9
Semax813.9Sequence: MEHFPGP
Selank751.9Sequence: TKPRPGP
Epitalon390.4Sequence: AEDG
Melanotan II1,024.2Cyclic; contains D-Phe and Nle.
PT-141 (Bremelanotide)1,025.2
MOTS-c2,174.6Sequence: MRWQEMGYIFYPRKLR
SS-31639.8Contains D-Arg and Dmt.
Thymosin α-13,108.3N-terminally acetylated in the native form.
AOD-96041,817.1
Kisspeptin-101,302.5Sequence: YNWNSFGLRF
DSIP848.8Sequence: WAGGDASGE
IGF-1 LR39,117.583-residue analogue.
Tirzepatide4,813.5
Retatrutide4,731.3
Cagrilintide3,748.2
NAD+663.4Dinucleotide, not a peptide.
Glutathione (reduced)307.3γ-linked at Glu; sequence shown for composition only.

Peptide Calculator Questions

Divide the peptide mass on the vial by the volume of diluent added. 10 mg in 2 mL is 5 mg/mL. Use the measured content from the lot’s certificate instead of the label mass for an exact figure.

mg/mL is mass per volume; molarity (mol/L) is number of molecules per volume and depends on molecular weight. The same 5 mg/mL is 3.52 mM for BPC-157 (1,419.5 g/mol) but only 1.04 mM for tirzepatide (4,813.5 g/mol).

Because labelled mass and measured mass differ. Eppix Labs certificates publish the measured milligrams for every lot; entering that ratio makes the concentration match what is actually in the vial.

Computed from the primary sequence of the free peptide, cross-checked against PubChem. Salt forms, acetylation, amidation and counter-ions shift the real figure; lot-specific values are on the certificate.

No. It is a laboratory reference for unit conversions and solution maths. Eppix Labs products are supplied for in vitro and laboratory research purposes only, and the company provides no dosing, administration or protocol guidance.

Laboratory reference only. This calculator performs standard unit conversions and solution arithmetic for research use. It does not constitute medical advice or administration guidance of any kind. All Eppix Labs products are supplied for in vitro and laboratory research purposes only and are not approved by Health Canada for any use in humans or animals.

Every lot’s measured content is on its certificate

Use the real number, not the label, in the calculator.

All products are supplied for in vitro and laboratory research purposes only.